PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G0972
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 563aa    MW: 61911.5 Da    PI: 7.2659
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G0972genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.36.9e-13400458563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr +r   NR +A rs qRK ++i+eLe+kv++L++e ++L  +l +l+  +a l+s++
  Gh_D02G0972 400 KRVKRILANRQSAARSKQRKMQYIAELEQKVQTLQTEATTLSAQLTMLQRDSAGLTSQN 458
                  8999*************************************************999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-19396460IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.128398461IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.0E-13400457No hitNo description
PfamPF001709.0E-11400458IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-12400455No hitNo description
CDDcd147032.96E-24401452No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MKMEGSNSIP KPQSNLDIPF SNASQMASPS PSPSYMRLSP ENNNSKRPGI PPSHPNNPTA  60
SLPYSQQIIG SRPNAQHGAP SHSRSLSQPT FFSLDRLPPW CPPPYRDPPV SSASDPASND  120
VSMEERFANS NVRSSLPSPV AGGCNEFRIG ESSSLPPRKG HRRSSSDVPL GFSTMIQSLP  180
QSIPIGNPGV LDRSVSGRET SFGVGKPIQL VKRESEWRKD SGSNLEVTSE RKSEVDVADD  240
LFNAYMNLEN LETLNSSGTE DRDMDSKASG TKTYGGESSD NEVDSRVHKH PISIQGMSSG  300
ISNEKREGVK RRAAGDIAPT VRHYRSVSMD SYMGSLQFDE DTPKIPPSGN HGNHHSPGSP  360
GDANSSKFNF ELGSSEFNES ELKKIMENEK LAEMASVDPK RVKRILANRQ SAARSKQRKM  420
QYIAELEQKV QTLQTEATTL SAQLTMLQRD SAGLTSQNNE LKFRLQAMEQ QAQLKDALNE  480
ALAAEVQRLK LTAAEFSGEV HLSNCMAQQL SIDHQMLQLQ PQQQQQRNIY QMQQQHQQPQ  540
QGHHNQSQTQ QQNGDASAAN VSK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1412420ARSKQRKMQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.147020.0boll
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1098686750.0
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478124.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478123.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478121.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478120.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478119.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478118.10.0PREDICTED: uncharacterized protein LOC105793819
TrEMBLA0A0D2SEH90.0A0A0D2SEH9_G
STRINGVIT_03s0038g00860.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-118bZIP family protein